PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G013200.4
Common NameB456_007G013200, LOC105801809
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 300aa    MW: 32903.1 Da    PI: 9.4528
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G013200.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.46.6e-133983147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r +WT+ E++++++a +++  + Wk+I +++g  +t  q++s+ qky
  Gorai.007G013200.4 39 RESWTEPEHDKFLEALQLFDRD-WKKIEAYVG-SKTVIQIRSHAQKY 83
                        789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.14E-163389IPR009057Homeodomain-like
PROSITE profilePS5129414.7463488IPR017930Myb domain
TIGRFAMsTIGR015571.0E-183786IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.4E-63879IPR009057Homeodomain-like
SMARTSM007172.7E-103886IPR001005SANT/Myb domain
PfamPF002491.1E-103983IPR001005SANT/Myb domain
CDDcd001676.60E-84184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MALPGLGPLS TAETAASTVS SSEDPNKKIR KPYTISKSRE SWTEPEHDKF LEALQLFDRD  60
WKKIEAYVGS KTVIQIRSHA QKYFLKVQKS GTSEHLPPPR PKRKAAHPYP QKASKNVLGQ  120
PQVSEPLQSP AALLDTGYVL RSDPSLMLAD PVTRAAASPQ TNNAQTISFA QDKKGPGMAN  180
NSCSSTESTR KGTEVGDTTD QGNHGHALRV LPDFAQVYSF IGSVFDPNTK GHMQKLKKMD  240
PIDVETVLLL MRNLSINLTS PDFEDHRRLL SSYEIDTETN NINSGACKAV DNSQSKRIT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.1390.0flower|seedling| flowering
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488560.10.0PREDICTED: protein REVEILLE 6-like isoform X2
SwissprotQ8H0W31e-129RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A0D2QJ450.0A0A0D2QJ45_G
STRINGVIT_16s0050g01180.t011e-138(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-112MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]